PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DS_0F2500A60.1
Common NameWRKY72-b
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 191aa    MW: 21078.9 Da    PI: 9.3424
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DS_0F2500A60.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.62.6e-3398156159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg+H+h+
  Traes_2DS_0F2500A60.1  98 LDDGYRWRKYGQKAVKNNNFPRSYYRCTHQGCNVKKQVQRLSRDEGVVVTTYEGTHTHP 156
                            59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.2E-3583156IPR003657WRKY domain
SuperFamilySSF1182905.23E-3090157IPR003657WRKY domain
PROSITE profilePS5081130.11393158IPR003657WRKY domain
SMARTSM007741.1E-3998157IPR003657WRKY domain
PfamPF031062.7E-2799156IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
TSNSYHFVAG ASSHDHLHHH GQAAGNNSSG GGGLNQGLFP GAKQEEPSNS KDGGGDDGAG  60
SSSQGVGEAD VVVGRKKGEK RERRPRFAFQ TRSQVDILDD GYRWRKYGQK AVKNNNFPRS  120
YYRCTHQGCN VKKQVQRLSR DEGVVVTTYE GTHTHPIEKS NDNFEHILTQ MQVYSGINNV  180
SQTFGNQHMF Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-2789157876Probable WRKY transcription factor 4
2lex_A1e-2789157876Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF3683630.0EF368363.1 Triticum aestivum WRKY transcription factor (WRKY72-b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577566.13e-87PREDICTED: probable WRKY transcription factor 75
TrEMBLA3FBG31e-141A3FBG3_WHEAT; WRKY transcription factor
TrEMBLM8BHK01e-141M8BHK0_AEGTA; Putative WRKY transcription factor 75
TrEMBLW5C3271e-141W5C327_WHEAT; Uncharacterized protein
STRINGMLOC_36657.11e-103(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110038133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.14e-56WRKY DNA-binding protein 75